PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT21213
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 206aa    MW: 22731.8 Da    PI: 9.0117
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT21213genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.43e-33113171159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg+H+h+
  EMT21213 113 LDDGYRWRKYGQKAVKNNNFPRSYYRCTHQGCNVKKQVQRLSRDEGVVVTTYEGTHTHP 171
               59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.0E-3598171IPR003657WRKY domain
SuperFamilySSF1182906.15E-30105172IPR003657WRKY domain
PROSITE profilePS5081130.113108173IPR003657WRKY domain
SMARTSM007741.1E-39113172IPR003657WRKY domain
PfamPF031063.1E-27114171IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MENYPILFGT QPSSSTSNSY HFVAGASSHD HLHHHGQAAG NNSSGGGGLN QGLFPGAKQE  60
EPSNSKDGGG DDGAGSSSQG VGEADVVVGR KKGEKRERRP RFAFQTRSQV DILDDGYRWR  120
KYGQKAVKNN NFPRSYYRCT HQGCNVKKQV QRLSRDEGVV VTTYEGTHTH PIEKSNDNFE  180
HILTQMQVYS GINNVSQTFG NQHMFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-27104172876Probable WRKY transcription factor 4
1wj2_A2e-27104172876Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF3683630.0EF368363.1 Triticum aestivum WRKY transcription factor (WRKY72-b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577566.18e-96PREDICTED: probable WRKY transcription factor 75
TrEMBLA3FBG31e-154A3FBG3_WHEAT; WRKY transcription factor
TrEMBLM8BHK01e-154M8BHK0_AEGTA; Putative WRKY transcription factor 75
STRINGMLOC_36657.11e-115(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110038133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.16e-56WRKY DNA-binding protein 75